Protein Info for Atu0601 in Agrobacterium fabrum C58

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 transmembrane" amino acids 403 to 424 (22 residues), see Phobius details PF01494: FAD_binding_3" amino acids 33 to 65 (33 residues), 23.9 bits, see alignment (E = 5.7e-09) PF01266: DAO" amino acids 34 to 385 (352 residues), 227.5 bits, see alignment E=9e-71 PF00890: FAD_binding_2" amino acids 34 to 70 (37 residues), 21.3 bits, see alignment 3.5e-08 PF13450: NAD_binding_8" amino acids 37 to 67 (31 residues), 23.1 bits, see alignment (E = 1.9e-08)

Best Hits

Swiss-Prot: 68% identical to ORDL_RHIME: Probable oxidoreductase OrdL (ordL) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to atu:Atu0601)

Predicted SEED Role

"Oxidoreductase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK55 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Atu0601 oxidoreductase (Agrobacterium fabrum C58)
MTWQSPIAPGLSWYQATVGERPDYPALDGSKQVDVAIIGGGYTGLQAACNLAENGVSVAL
IEAHRFGDGASGRNGGQFGTGQRSFPDEMEGEIGFEQSKLLFDIAEDAKNYVRDFASSRG
IDMDYLPGQLYVAHKAAYEDDYRRSVDAMNNRYGYPHISYMERGEARKRVGSTHYFGGTR
DTGTGHIHPLKLLVGLAKAAKAAGADIYEMTPAKSIRQIGGKTIIKTPFGTISAPRVLIA
TNAYIGNLEPVTAAHIMPIRSFIGATAPLDAYPDIIPGKEAVADSRFVVRYFRKTTDNRL
LFGGREAYTADAPRDISSHIRRQIAEIYPELKAVEITHSWGGSVGITLPRKVFVREVMPG
VTSIGGYSGHGVMLSNYCGKLYADLVLGKKDMLAPFARLKVPAFPGGASLRAPLLFMALS
WFALRDRF