Protein Info for Atu0593 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details amino acids 351 to 370 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 188 to 377 (190 residues), 46.9 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 72% identical to AGLG_RHIME: Alpha-glucoside transport system permease protein AglG (aglG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10234, alpha-glucoside transport system permease protein (inferred from 100% identity to atu:Atu0593)

Predicted SEED Role

"Alpha-glucoside transport system permease protein AglG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK58 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Atu0593 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MNIIKRLRRVGLPRLIVHASVLLVVLLWLLPTLGILVSSLRDKDQITVSGWWTAFSSSEQ
TAAVRLADASVQKQDGSRYVIAGNVFENGQGGKVAAFGVRVQEPTAFKAGEAADIGDGET
LLVNSDGTYEYSKAVSFEGSRGKRVYISVATPPVFTLDNYRTVLTSEGIGQSFVNSLTVA
VPATVIPILIAAFAAYALSWMNFSGRNLLIAMVVGLIVVPLQMSLIPLLRLYNEIGTIFG
VPSKTYAGIWLAHTAFGLPLAIYLLRNYISGLPKEIIESARVDGASDFEIFVKIILPLSF
PALASFAIFQFLWTWNDLLVAMVFLGTQKDELVLTGALNALLGSRGGNWEILTASAFVTI
IVPLGVFFALQRYLVRGLLAGSVKGG