Protein Info for Atu0582 in Agrobacterium fabrum C58

Annotation: flagellar biosynthetic protein FLIR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 200 to 226 (27 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 1 to 233 (233 residues), 188.8 bits, see alignment E=6.5e-60 PF01311: Bac_export_1" amino acids 1 to 233 (233 residues), 185.1 bits, see alignment E=7.8e-59

Best Hits

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to atu:Atu0582)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK62 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Atu0582 flagellar biosynthetic protein FLIR (Agrobacterium fabrum C58)
MFLAICRIGACFMTMPGFSSSRISPQIRMLLCVAVSMALLPVLWDTIYPKVSGASQGAVV
GLIFSEVLIGAMYGLIARFYTLGFQFTGALIGASIGLSAPGGADPIEDVQENQIANFITF
GGLLVLFMMDFHHIVLKALVDSYSATPVGALISGQKMLITLTDTLRASFSIMLRLASPFV
IYGLMFNVAVGLINKLAPQIPVFFISTPFVLAGGLFMLYLSVAALIRQFVDGFGPVFIGF