Protein Info for Atu0562 in Agrobacterium fabrum C58

Annotation: flagellar motor switch protein FliN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 TIGR02480: flagellar motor switch protein FliN" amino acids 98 to 176 (79 residues), 99.6 bits, see alignment E=3.6e-33 PF01052: FliMN_C" amino acids 101 to 174 (74 residues), 64.6 bits, see alignment E=3.3e-22

Best Hits

Swiss-Prot: 100% identical to FLIN_AGRFC: Flagellar motor switch protein FliN (fliN) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 100% identity to atu:Atu0562)

Predicted SEED Role

"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q57259 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Atu0562 flagellar motor switch protein FliN (Agrobacterium fabrum C58)
MATKKTPVTDDAALPSFEDGVDLDQAIGDLRGVLKTDAEGSLSDFGDFGDFGSTDEVSTD
NDLSAFGGGAADFAMDDFAAAPQVAGVKAPLGSGLSENMEMIMDIPIDVQIVLGTSRMLV
SGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDDDTRFGVKLIEVLSTRKA