Protein Info for Atu0553 in Agrobacterium fabrum C58

Annotation: flagellar hook-basal body complex protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF02049: FliE" amino acids 31 to 112 (82 residues), 60.9 bits, see alignment E=5.6e-21

Best Hits

Swiss-Prot: 100% identical to FLIE_AGRFC: Flagellar hook-basal body complex protein FliE (fliE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 100% identity to atu:Atu0553)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44337 at UniProt or InterPro

Protein Sequence (112 amino acids)

>Atu0553 flagellar hook-basal body complex protein (Agrobacterium fabrum C58)
MIDGIKQLGSLSLTRGASGVSSLTESLFGGEQQSTPAQQTGASFASVLGNVSMDAMNNLK
KAEVASFEGIQGKANTREVVDAVLSAEQSLQTAIALRDKIVSAYLDITKMQI