Protein Info for Atu0548 in Agrobacterium fabrum C58

Annotation: flagellar L-ring protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF02107: FlgH" amino acids 62 to 238 (177 residues), 179.7 bits, see alignment E=2e-57

Best Hits

Swiss-Prot: 100% identical to FLGH_AGRFC: Flagellar L-ring protein (flgH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 100% identity to atu:Atu0548)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44342 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Atu0548 flagellar L-ring protein precursor (Agrobacterium fabrum C58)
MSTRRLPALLLPLALLAGCQNNQTLKEIGNAPAMSPIGSGLQFSQTPQMGMYPKQPKHMA
SGYSLWSDSQGALFKDLRALNIGDILTVNIQINDKADFDNETERNRTNASGLNWKAKAQI
LGWTPDADSSIKYGSDTDTQAKGKTKRSEKLTLLVAAVVTGILENGNLIISGSQEVRVNH
EIRILNVGGIVRPQDVDAQNIISYERIAEARISYGGRGRLTEVQQPPVGQQVVDLFSPL