Protein Info for Atu0546 in Agrobacterium fabrum C58

Annotation: flagellar biosynthetic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 63 (28 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 46 to 244 (199 residues), 314.2 bits, see alignment E=1.8e-98 PF00813: FliP" amino acids 46 to 240 (195 residues), 249.4 bits, see alignment E=1.4e-78

Best Hits

Swiss-Prot: 100% identical to FLIP_AGRFC: Flagellar biosynthetic protein FliP (fliP) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to atu:Atu0546)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44344 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Atu0546 flagellar biosynthetic protein (Agrobacterium fabrum C58)
MIRFLVTIAVLLALPGLANAQQFPSDLFNTQIDGSVAAWIIRTFGLLTVLSVAPGILIMV
TSFPRFVIAFSILRSGMGLASTPSNMILLSMAMFMTFYVMSPTFDKAWTDGVQPLLQNQI
NEQQAVQRIAEPFRTFMNANTRDKDLKLFVDIARERGQVVMTDNVVDYRVLVPAFMLSEI
RRGFEIGFLIILPFLVIDLIVATITMAMGMMMLPPTSISLPFKILFFVLIDGWNLLVGSL
VRSFN