Protein Info for Atu0528 in Agrobacterium fabrum C58

Annotation: large conductance mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details PF01741: MscL" amino acids 1 to 140 (140 residues), 155.1 bits, see alignment E=5.4e-50 TIGR00220: large conductance mechanosensitive channel protein" amino acids 1 to 141 (141 residues), 128.6 bits, see alignment E=8e-42

Best Hits

Swiss-Prot: 100% identical to MSCL_AGRFC: Large-conductance mechanosensitive channel (mscL) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to atu:Atu0528)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UHY0 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Atu0528 large conductance mechanosensitive channel protein (Agrobacterium fabrum C58)
MLNEFKTFIARGNVMDLAVGVIIGAAFSKIVDSVVNDLIMPIVGAIFGGFDFSNYFLPLS
SNVNATSLAAAREQGAVFAYGNFLTVLINFLILAWIIFLMVKGVNKLRDSVDRKKIEEKP
DAAPPPEDVKLLTEIRDLLKTR