Protein Info for Atu0521 in Agrobacterium fabrum C58

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF03975: CheD" amino acids 53 to 147 (95 residues), 91.9 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 100% identical to CHED_AGRFC: Probable chemoreceptor glutamine deamidase CheD (cheD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03411, chemotaxis protein CheD [EC: 3.5.1.44] (inferred from 98% identity to agr:AGROH133_03877)

Predicted SEED Role

"Chemotaxis protein CheD" in subsystem Bacterial Chemotaxis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1A4 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Atu0521 methyl-accepting chemotaxis protein (Agrobacterium fabrum C58)
MMEAAAKRVHIIQGEYKVVSDPDVVMTTILGSCVAACLRDPVAGLGGMNHFLLPGTGNVT
GGDATRYGVHLMELLINGLLKQGARRDRLEAKVFGGAKTIASFSNVGEQNAIFAMQFLKD
EGIPVISSSTGGDHGRKIEFWPVSGRARQHPLSGAETQKTVAMETRPVPAPKPVANDIEF
F