Protein Info for Atu0518 in Agrobacterium fabrum C58

Annotation: chemotaxis methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF03705: CheR_N" amino acids 28 to 78 (51 residues), 46.1 bits, see alignment 3.2e-16 PF01739: CheR" amino acids 94 to 291 (198 residues), 246.9 bits, see alignment E=1.2e-77

Best Hits

Swiss-Prot: 83% identical to CHER_RHIEC: Probable chemotaxis protein methyltransferase (cheRch1) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 100% identity to atu:Atu0518)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1A6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Atu0518 chemotaxis methyltransferase (Agrobacterium fabrum C58)
MAALNLSDQRQSPDDVLASGEYPLTRRDLSEIAAMIYADAGIYLNDTKASLVYSRLSKHI
RNLGLSGFREYCALVSSSEGAQPRREMLSHLTTNFTRFFRENHHFEHLRDEVLPGLIARA
KSGGRVRIWSAACSDGQEPYSIALTVLAMFPNAADYDFKILATDIDPKILAQARAGVYDD
NALETVSPAMRKQWFTEVDAGGRRKFRIDDKVKRLITFNELNLMTQWPFKGNFDVIFCRN
VVIYFDEPTQVRIWSRFAGLLPEGGHLYIGHSERVSGDAKNVFDNTGITTYRFIGHASGR
KA