Protein Info for Atu0498 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 171 to 200 (30 residues), see Phobius details amino acids 206 to 231 (26 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF01925: TauE" amino acids 18 to 287 (270 residues), 172.6 bits, see alignment E=5.9e-55

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to atu:Atu0498)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1C4 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Atu0498 hypothetical protein (Agrobacterium fabrum C58)
MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIFYNIPPVVAVATGANQ
VVASSVSGSITHFRRGTLDIKLGTVLLVGGLVGATVGVWIFSFLRSIGQLDLIVSLLYVI
LLGTVGTLMLKESISALRRAARNETVTLRRPGHHNWVHRLPLKMRFKKSKIYLSIIPIVA
LGFGIGILTSIMGVGGGFIMVPAMIYLLRIPTSVVVGTSLFQIIFVTAYTTVVQAATNYS
VDVVLAFILMVAGVIGAQYGVRVGQKLRGEQLRALLALLVLAVALRLAVSLVVRPEDLFS
VAVGGLGY