Protein Info for Atu0492 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 PF02627: CMD" amino acids 12 to 93 (82 residues), 70.7 bits, see alignment E=4.2e-24 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 37 to 76 (40 residues), 39.7 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 36% identical to YDFG_BACSU: Uncharacterized protein YdfG (ydfG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0492)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase domain/alkylhydroperoxidase AhpD family core domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1C9 at UniProt or InterPro

Protein Sequence (153 amino acids)

>Atu0492 hypothetical protein (Agrobacterium fabrum C58)
MKTRINYAKASPEAFKAVMALENYVQSSGLEHRFIHLIKLRASIINGCAFCVDMHVKESR
HDGLSEQWINLMSVWRESPVYTEQERALLGWVDAVTKIAETGAPDDAFETLRAHFSDEEI
VKITVAIGAINTWNRIAVGFRSQHPVEAAAKAA