Protein Info for Atu0486 in Agrobacterium fabrum C58

Annotation: dihydroorotate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 10 to 348 (339 residues), 387 bits, see alignment E=3.4e-120 PF01180: DHO_dh" amino acids 45 to 336 (292 residues), 271.9 bits, see alignment E=3.2e-85

Best Hits

Swiss-Prot: 100% identical to PYRD_AGRFC: Dihydroorotate dehydrogenase (quinone) (pyrD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 100% identity to atu:Atu0486)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK85 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Atu0486 dihydroorotate dehydrogenase (Agrobacterium fabrum C58)
MSGLFSSVGRKGLFLIDPEKAHGLSVAALKSGFLPTCMVPHDPRLQQTVAGLVFPNPLGM
AAGYDKNAEVPGPLLRLGFGFTEIGTVTPRAQSGNPKPRIFRLVEDEGVINRLGFNNEGH
AAALERLTQARLRGIVGVNIGANKDSEDRIADYVQGIEAFYAVASYFTVNISSPNTPGLR
DLQARESLAALLTAVLERRKTEAERLGKRIPIFLKIAPDLTEEGLDDVAEEALAHDLDGL
IVSNTTLSREGLRPGPHRGEAGGLSGKPLFELSTTVLAKMRRRVGANLPIIGVGGVSSAE
TALEKVRAGADLVQLYSCMVYEGPGLPSAIVKGMSKLVAREGVETIRDLRDSAVDRWADR
KLG