Protein Info for Atu0429 in Agrobacterium fabrum C58

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 5 to 145 (141 residues), 169.4 bits, E=5.7e-54
• TIGR00658: ornithine carbamoyltransferase
  • amino acids 5 to 302 (298 residues), 386.8 bits, E=3.4e-120
• PF00185: OTCace
  • amino acids 151 to 301 (151 residues), 179.3 bits, E=5.7e-57

Best Hits

Swiss-Prot: 100% identical to OTC_AGRFC: Ornithine carbamoyltransferase (argF) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0429)

MetaCyc: 54% identical to ArgF (Bacillus subtilis)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-citrulline degradation (3/3 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See Q8UI70 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Atu0429 ornithine carbamoyltransferase (Agrobacterium fabrum C58)
MASPKHFLDLSAVGPQDLRTILDDARARKVATKAGTAEKPLAGKMLAMIFEKPSTRTRVS
FDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMIRTTDHSRLLELAEHAT
VPVINGLTDDTHPCQIMADIMTFEEHRGPVKGKTIAWTGDGNNVLHSFVEGSARFGYRMT
MAVPMGSEPHDKFMNWARNNGGEIALYHDADKAVAGADCVVTDTWVSMNQEHKARGHNIF
QPYQVNEALMAKAQKDALFMHCLPAHRGEEVTDAVIDGPQSVVFDEAENRLHAQKSVIAW
CMGVI