Protein Info for Atu0425 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 2 to 225 (224 residues), 344.6 bits, see alignment E=1e-107 PF00072: Response_reg" amino acids 5 to 117 (113 residues), 96 bits, see alignment E=1.7e-31 PF00486: Trans_reg_C" amino acids 151 to 224 (74 residues), 93.7 bits, see alignment E=6e-31

Best Hits

Swiss-Prot: 93% identical to PHOB_RHIME: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 100% identity to agr:AGROH133_03706)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKA3 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Atu0425 two component response regulator (Agrobacterium fabrum C58)
MVPKIAVVEDEEALSVLLRYNLEAEGYDVDTIPRGDEAEIRLQERIPDLLILDWMLPGVS
GIELCRRLRMRPETERLPIIMLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAML
RRARPEVLSSVLKCGDIELDRETHRVHRKSREVRLGPTEFRLLEFLMTSPGRVFSRSQLL
DGVWGHDIYVDERTVDVHVGRLRKALNFSHMQDVIRTVRGAGYSMEA