Protein Info for Atu0422 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 220 to 247 (28 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 367 to 377 (11 residues), see Phobius details amino acids 413 to 432 (20 residues), see Phobius details PF11812: DUF3333" amino acids 23 to 173 (151 residues), 184 bits, see alignment E=1.9e-58 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 198 to 437 (240 residues), 228 bits, see alignment E=6.3e-72 PF00528: BPD_transp_1" amino acids 240 to 439 (200 residues), 70.2 bits, see alignment E=2e-23

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to atu:Atu0422)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKA5 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Atu0422 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MTDIVSPAAGGSAVNKATRRDIGIKRRYAAERRFRAYGMAAISFGLLFLFLLLFSVVSKG
YTAFQQTMITVPVEFSEQIIDPKNERATNPAKLMTANYPVVARDAVAKVLGIAPTDRAGL
RAVNLLISDSVRTQLRDIVVADPAVIGTTRTVTLLASGDVDSAFKGQVDLTADEANRRIS
NQQLGWMNQLAESGQLGKHFNTGIFINGASSRPEAAGVGVALIGSFYMMLIVLVLALPIG
VAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGLLGLSVFINFMGFPRSASLVGGLV
LTLMTLPTIIIATRAALKAVPPSIRAAALGLGASKMQTIFHHVLPLAMPGILTGTIIGLA
HALGETAPLLLIGMVAFVANYPTTPMDPSTALPVQIYMWANEAERAFVERTSGAIIILLL
FLIVMNVGAILLRRRFERRW