Protein Info for Atu0420 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (phosphate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF12849: PBP_like_2" amino acids 18 to 310 (293 residues), 196.7 bits, see alignment E=3.4e-62

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 100% identity to agr:AGROH133_03685)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKA7 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Atu0420 ABC transporter, substrate binding protein (phosphate) (Agrobacterium fabrum C58)
MNFVKFSAAALVASVAFAGAAAARDQIQVAGSSTVLPYAKIVAETFAETFPNFKAPVVES
GGTGGGLKAFCSGVGEGTIDIANASRPIKSDELAACKAAGVADVQEVKIGYDGIVFAMDS
SNKDIKLEPKDLYLALAAEIVKDGKLVANPYKKWSEINKELPDVAIAAYIPGSKHGTREV
FEEKIMADGCKEAKATDAIKALITDAKQAAAKCVAVRKDGAAVDIDGDYTETLARIDANK
TGLGVFGLAFYENNADRLKVATVSGVVPSTETVASGKYPVSRPLFFYVKKAHLGVIPGLK
EYVEFFVSDEMIGPDSPLANYGLVAAPDKEREEIRSKFAAGASM