Protein Info for Atu0419 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 30 to 47 (18 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 95 to 433 (339 residues), 375.5 bits, see alignment E=1e-116 PF00512: HisKA" amino acids 211 to 276 (66 residues), 68.6 bits, see alignment E=3.8e-23 PF02518: HATPase_c" amino acids 324 to 433 (110 residues), 90.2 bits, see alignment E=1.2e-29

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu0419)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1H9 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Atu0419 two component sensor kinase (Agrobacterium fabrum C58)
MLSDESGEQAEMAVREGESGLRLLGKKLGRNWLPVLIVSMLAVVAVTELHTPYMPAALWL
CAIIAILAVREKPAAPEKDKETAADVDEPDVPGENVISGVRAGLAVLDTPVFILDKNASV
LFQNGAAERAFGQLPAGAHISARLRSPGLLDVIRETITTGQPNQVEHSERFPSERVFIVR
IARADVGEGASPPFYILSFRDVSELRRIDRMRSDFVANASHELRTPLASLRGFIETMQGP
ARNDPKAQERFLAIMLDQATRMSRLVDDLMSLSRLELRANIAPDQKVDLVPVIGHVRDAL
LPLADELDVTITLHLPDRPAEVQGDRDELVQVFQNLVENACKYGQEGKVVDVWLRAEPGK
PVEVSIIDKGPGIPAEHVPRLTERFYRVSVADSRSKKGTGLGLAIVKHILTRHRARLIIK
SEMGSGTDFTVRF