Protein Info for Atu0409 in Agrobacterium fabrum C58

Annotation: ferrichrome iron receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF07715: Plug" amino acids 71 to 174 (104 residues), 91.1 bits, see alignment E=6.3e-30 TIGR01783: TonB-dependent siderophore receptor" amino acids 73 to 726 (654 residues), 360.2 bits, see alignment E=1.3e-111 PF00593: TonB_dep_Rec_b-barrel" amino acids 250 to 698 (449 residues), 203 bits, see alignment E=1.6e-63

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to atu:Atu0409)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1I4 at UniProt or InterPro

Protein Sequence (729 amino acids)

>Atu0409 ferrichrome iron receptor (Agrobacterium fabrum C58)
MKNLHGMFLSRLALGTAAVVLMGPVMGHAQETTVLKQITVEGQGAENATGPVRGYVAKKS
ATGSKTETETKAIPQSVSVVGRQEMDDRGAVTKIDEVLRYTPGVTAEPFGTDPDTDWFYI
RGFQATQTGVFLDGLNLFSYGFGGFQMDAYGLERVEVLKGPASVLYGGANPGGIVQMVSK
RAQDTPVRETEIGINNFGNAFFGFDLGDKVDAEGVWKYRVTGKVSGGDNYTDYSEDLRGF
IMPQITFEPDAQTSATLYGYFSALDQVHVGNGFLPYVGTVVDAPFGKLDRKAFYGEPDID
NGRVYQSMVGYDVSHEFDNGWKISQNARYGHLYKHETGPYPGGWANADANGQPILDPITN
DYMLTRFGYDGLSKVDSFGVDNRIEGQFDTGAVNHSPLFGLDYKYYRLDQVQACCGSNAI
GALKPVYGSTQGTNFVYADNIVTQQQIGIYAQDQLRFGDGWLVTLNGRYDYVDTELNNRL
PAGVSRRSNDDALSGRAGLAYEFDNGLTPYVSAATFFNPLIDTLADGTPASPEEGHQFEA
GIKYEPSFFDGSITASVFKLVKDNAIVSYTAGGVTTSGQFGQVESTGFELEAKANLDENW
KALASYSYTDLDITKDANPNLIGKSPWIVPAHTASLWVDYAFTDETFEGLSIGGGVRYQG
KSWADAANTLRVSDAAVFDAAIRYEKNDWTASVNVANVFDKEYVKSCAGVSVCGWGDSRT
ITLKLSKKW