Protein Info for Atu0407 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (iron)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 35 to 283 (249 residues), 57.4 bits, see alignment E=5e-19 PF13531: SBP_bac_11" amino acids 37 to 288 (252 residues), 47.4 bits, see alignment E=4.2e-16 PF13416: SBP_bac_8" amino acids 41 to 304 (264 residues), 46.9 bits, see alignment E=6.5e-16 PF13343: SBP_bac_6" amino acids 72 to 302 (231 residues), 63.7 bits, see alignment E=3.9e-21

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 100% identity to atu:Atu0407)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKB1 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Atu0407 ABC transporter, substrate binding protein (iron) (Agrobacterium fabrum C58)
MTKFTRFALLASTVAFAAGTVSAAELNIYTTREPGLIQPLLESFTASSGVKVNTVFLKDG
LAERVLSEGASSPADVLMTVDAGNLVDLAEKGVTQAVESETLTKAVPAELRDAKGHWFAL
SMRARVLYAAKDLDLASFNYEDLADAKWKGKVCIRAGQHPYNTALFADYIAHYGAADTEK
WLAGVKENLARKAGGGDRDVAKDILGGICDIGIANSYYVGLMRSGKGGEEQVKWGDAIKV
VLPTFKNGGTQVNISGAAVAKNAPNKAEAVKLLEYLVSDEAQKIYAEANYEYPVKQGAAL
NEIVASFGTLKIDNKPLTEIVSHRKQASELVDKVGFDK