Protein Info for Atu0399 in Agrobacterium fabrum C58

Annotation: dihydroorotase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR00856: dihydroorotase, homodimeric type" amino acids 4 to 332 (329 residues), 428.1 bits, see alignment E=1.1e-132 PF01979: Amidohydro_1" amino acids 11 to 305 (295 residues), 72.8 bits, see alignment E=1.7e-24

Best Hits

Swiss-Prot: 100% identical to PYRC_AGRFC: Dihydroorotase (pyrC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01465, dihydroorotase [EC: 3.5.2.3] (inferred from 100% identity to atu:Atu0399)

MetaCyc: 57% identical to dihydroorotase (Escherichia coli K-12 substr. MG1655)
Dihydroorotase. [EC: 3.5.2.3]

Predicted SEED Role

"Dihydroorotase (EC 3.5.2.3)" in subsystem De Novo Pyrimidine Synthesis (EC 3.5.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.3

Use Curated BLAST to search for 3.5.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UI99 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Atu0399 dihydroorotase (Agrobacterium fabrum C58)
MKSLTLRRPDDWHLHLRDGAMLEGVIGDTSRHFARAIIMPNLVPPVVTTADASAYRERIL
KAIPEGDRFEPLMTLYLTEDTVADDVEEGKKSGLITAVKLYPAGATTNSHGGVRDFNKAM
PVLERMAKIGLPLCVHGEVTTPDVDIFDREKAFIDTVLEPLRQRLPELKVTMEHITTRDG
VDYIKSSNANLAGSITTHHLIINRNAILVGGIKPHYYCLPVAKREEHRLALRAAATSGDA
RFFLGTDSAPHVDPLKECACGCAGIYTSINTMSCLAHVFEDENALDKLEAFASLNGPAWY
GLAPNDETITLVKREEAVAFPEKIETGAGPVTVFDPMFPLHWDVN