Protein Info for Atu0390 in Agrobacterium fabrum C58

Annotation: ubiquinone/menaquinone biosynthesis methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF01209: Ubie_methyltran" amino acids 32 to 142 (111 residues), 57.7 bits, see alignment E=2.9e-19 PF13847: Methyltransf_31" amino acids 43 to 146 (104 residues), 43.1 bits, see alignment E=9.6e-15 PF13649: Methyltransf_25" amino acids 44 to 138 (95 residues), 70.9 bits, see alignment E=3e-23 PF08241: Methyltransf_11" amino acids 45 to 142 (98 residues), 74.2 bits, see alignment E=2.7e-24 PF08242: Methyltransf_12" amino acids 45 to 139 (95 residues), 50.3 bits, see alignment E=8.5e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0390)

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1K0 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Atu0390 ubiquinone/menaquinone biosynthesis methyltransferase (Agrobacterium fabrum C58)
MLEADKVFAGSIPENYDRYMVPLIFAPFAADLARRAAALMPIDVLEIAAGTGAVTREMIP
RLLPAAHYVVTDLNQPMLDFAAAQQAPDNRIKWRQADAQLLPFENAVFDLVFCQFGAMFF
NDRLSAYREAKRVLKPGGHYLFNVWDRIEENHFADDVTNALAGLFPDDPPRFMARTPHGY
HDTVLIRRELENAGFSRVTVETVAAQSRAPSPRIPAVAYCQGTVLRTEIEARAPGKLNAA
TDCAAAAIEARHGKGEVAAKIKAHVILAAV