Protein Info for Atu0378 in Agrobacterium fabrum C58

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 TIGR01993: pyrimidine 5'-nucleotidase" amino acids 19 to 196 (178 residues), 239.2 bits, see alignment E=2.8e-75 PF13419: HAD_2" amino acids 21 to 196 (176 residues), 30.3 bits, see alignment E=4.1e-11 PF00702: Hydrolase" amino acids 21 to 191 (171 residues), 57.6 bits, see alignment E=2.3e-19 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 56 to 196 (141 residues), 43.2 bits, see alignment E=4.7e-15

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to atu:Atu0378)

Predicted SEED Role

"Pyridoxal-5'-phosphate phosphatase (EC 3.1.3.74), Alphaproteobacterial type" (EC 3.1.3.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1K5 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Atu0378 hydrolase (Agrobacterium fabrum C58)
MDTKPKNLPDAADFAHVSEWVFDLDNTLYPHHVNLFSQIDRNMTAYVAELLKLDPEEARV
LQKRYYHDHGTTLQGLMINYGISPDEFLERAHAIDYSALKPHPELGEAIKALPGRKFILT
NGSVKHAQAAAGALGILDHFEDIFDIVAANYLPKPASATYEKFAALAKLDTKKAAMFEDL
PRNLAAPKALGMKTVLLVPSNLEGVIMERWEIPDVTDEHIDYITDDLTGFLAKTIAR