Protein Info for Atu0360 in Agrobacterium fabrum C58

Annotation: apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 128 (29 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 505 to 525 (21 residues), see Phobius details PF20154: LNT_N" amino acids 23 to 191 (169 residues), 78.4 bits, see alignment E=7e-26 TIGR00546: apolipoprotein N-acyltransferase" amino acids 76 to 473 (398 residues), 349.8 bits, see alignment E=1.2e-108 PF00795: CN_hydrolase" amino acids 239 to 490 (252 residues), 108.6 bits, see alignment E=3.5e-35

Best Hits

Swiss-Prot: 100% identical to LNT_AGRFC: Apolipoprotein N-acyltransferase (lnt) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu0360)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UID7 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Atu0360 apolipoprotein N-acyltransferase (Agrobacterium fabrum C58)
MERLAGRVMLAGGMSRAVMAIAAGAVGALALPPFGFFAALFFSFTLLVWLVDGCTGKPGG
GLFSRILPAFGIGWCFGFGYFVAGLWWLGNALLLEADEFAWALPLAILGLPALLALFYGF
AVAAANLLWSDGLGRIAALAAAFGVSEWLRSFLATGFPWNAIGYGIMPIPIMMQSAHLLG
LLSITTLAVFIFASPALIGTKKGMGPGLALAGLLLAAHFGYGFYRLQTPAETPADALTVR
IVQPAIDQSRKMLNTDRAEIFAEHLRLSALPPGEGKKRPDIIVWPETSVPFILTQNPDAL
AEIASTLEDGQVLFTGAVRMEDQGAGRPPRYYNSVYAIDSQGEIIGATDKVHLTPFGEYV
PFEGILREFGIDNVIALPGGFSAASSRTPLTLPSGKTFYPLICYEIIFPGEMTPGLQGAA
AILNVTNDGWFGDTPGPYQHFLQARVRAVETGVPVIRGANTGISAVIDPYGRIIAGLDYG
RVGILDATLSGGSNDAFTYDTHRTYFWLIFSILMIVAVFPALSFARRQN