Protein Info for Atu0345 in Agrobacterium fabrum C58

Annotation: DNA mismatch repair protein, MutS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 883 PF01624: MutS_I" amino acids 1 to 115 (115 residues), 144.8 bits, see alignment E=3.7e-46 TIGR01070: DNA mismatch repair protein MutS" amino acids 1 to 878 (878 residues), 845.4 bits, see alignment E=2.8e-258 PF05188: MutS_II" amino acids 124 to 251 (128 residues), 81.2 bits, see alignment E=2.9e-26 PF05192: MutS_III" amino acids 272 to 570 (299 residues), 146.2 bits, see alignment E=4.7e-46 PF05190: MutS_IV" amino acids 433 to 529 (97 residues), 77.7 bits, see alignment E=2e-25 PF00488: MutS_V" amino acids 630 to 817 (188 residues), 290.5 bits, see alignment E=2e-90 PF27441: MutS_C" amino acids 849 to 878 (30 residues), 54.5 bits, see alignment (E = 2.3e-18)

Best Hits

Swiss-Prot: 100% identical to MUTS_AGRFC: DNA mismatch repair protein MutS (mutS) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to atu:Atu0345)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UIF2 at UniProt or InterPro

Protein Sequence (883 amino acids)

>Atu0345 DNA mismatch repair protein, MutS family (Agrobacterium fabrum C58)
MMEQYIEIKANNPGSLLFYRMGDFYELFFDDAVEASRALGITLTKRGQHMGHDIPMCGVP
VHAADDYLQKLILRGYRVAVCEQIEDPAEAKKRGSKSVVKRDVVRLVTPGTLTEEKLLSP
TESNYLMALARIRGSAEAQFALAWIDISTGVFRLAETTLTRLLADIWRIDPRELIVADSL
FHDEELRPVFDVLGRVAVPQPAILFDSAVAEGRIARYFNVSTLDGFGTFSRVEMAAAAAA
VAYVEKTQIAERPPLGAPERESAASTLFIDPATRANLELVKTLSGDRDGSLLHALNRTVT
GGGARLLAERLMSPLTDPERINARLDAVAYLIDDVSLCDGLRDALKHVADMPRALSRLAL
ERGGPRDLGAIRQGLVSAEKIAVILDGGLLPDELAKALRDLKALPGALEAMLGSMLADDL
PLLKRDGGFLREGANPELDEVRALRDQSRRVIAGLQLQYADETGIKSLKIKHNNVLGYFI
EVTAGNADVMMATDEAKARFIHRQTMAGAMRFTTTELADLESRIANAAAEALTMELEAFE
RMVEAVVQQAEAIKAGALALAVIDVASSLAYLATEQAYCRPIVDASMTFSIKGGRHPVVE
QALRRQSAGPFIANNCDLSAVNGGKNGAIWLLTGPNMGGKSTFLRQNALIAILAQIGSFV
PAEAAHIGVVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQATDRSLVILDEIGRGTA
TFDGLSIAWAAVEHLHEVNRCRGLFATHFHELTVLSEKLGRLSNATMRVKEWEGDVIFLH
EVGPGAADRSYGIQVARLAGLPASVVERAREVLTKLEDADRKNPASQLIDDLPLFQIAVR
REETRKAGPSKVEEALKSFNPDEMTPREALDALYALKKELGKA