Protein Info for Atu0331 in Agrobacterium fabrum C58

Annotation: sigma-54 modulation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 100 (100 residues), 56.2 bits, see alignment E=2e-19 PF02482: Ribosomal_S30AE" amino acids 3 to 95 (93 residues), 66 bits, see alignment E=4.2e-22 PF16321: Ribosom_S30AE_C" amino acids 128 to 181 (54 residues), 55.4 bits, see alignment E=3.9e-19

Best Hits

Swiss-Prot: 79% identical to HPF_RHIME: Ribosome hibernation promotion factor (hpf) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0331)

Predicted SEED Role

"Ribosomal subunit interface protein" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1P1 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Atu0331 sigma-54 modulation protein (Agrobacterium fabrum C58)
MSVRVSGKHMEIGESFRQRIEDNIGLAVTKYFDGGYSGQVTVEKSGSRFAADCKLHLDTG
VVLHAAGQANDPQASFDAAAERIEKRLRRYKRKLKDHHSGSNGALPEIAYTVMDAVPDED
HEVPEDYAPTIVAESSKQIKTMSVASAVMALDMTDEPVLLFRSPGKEYLNIVYRRHDGNI
GWIDAETIKS