Protein Info for Atu0330 in Agrobacterium fabrum C58
Annotation: nitrogen regulatory IIA protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to PTSN_BRADU: Nitrogen regulatory protein (ptsN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
KEGG orthology group: K02806, PTS system, nitrogen regulatory IIA component [EC: 2.7.1.69] (inferred from 99% identity to agr:AGROH133_03493)Predicted SEED Role
"PTS system nitrogen-specific IIA component, PtsN"
KEGG Metabolic Maps
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Fructose and mannose metabolism
- Galactose metabolism
- Glycolysis / Gluconeogenesis
- Nucleotide sugars metabolism
- Starch and sucrose metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.7.1.69
Use Curated BLAST to search for 2.7.1.69
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CKE0 at UniProt or InterPro
Protein Sequence (153 amino acids)
>Atu0330 nitrogen regulatory IIA protein (Agrobacterium fabrum C58) MALADLLQQDAIIPALKVNSKKQLLQELAAKAARITGVSEREVFDVILQREKLGSTGVGH GIAIPHGKLNSIHQITGVFARLETPVDFEALDDQPVDLVFLLLAPEGAGADHLKALSRIA RALRDPELVTKLRATDSDTAIYAFLNQEQATAA