Protein Info for Atu0324 in Agrobacterium fabrum C58

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 PF11638: DnaA_N" amino acids 38 to 99 (62 residues), 58.2 bits, see alignment E=7.9e-20 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 41 to 514 (474 residues), 486 bits, see alignment E=6e-150 PF00308: Bac_DnaA" amino acids 176 to 337 (162 residues), 214.9 bits, see alignment E=1.1e-67 PF08299: Bac_DnaA_C" amino acids 426 to 494 (69 residues), 107.5 bits, see alignment E=4.3e-35

Best Hits

Swiss-Prot: 100% identical to DNAA_AGRFC: Chromosomal replication initiator protein DnaA (dnaA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to atu:Atu0324)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UIH1 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Atu0324 chromosomal replication initiator protein DnaA (Agrobacterium fabrum C58)
MQLNLAMGAVADGDRAPKACDAACSEAAGDKSAMMHDALFERFSARLKAQVGPEVYASWF
ARLKLHTVSKSVVRFTVPTTFLKSWINNRYMDLITSLVQSEDPDVLKVEILVRSASRPVR
PAQTEERAQPVQEVGAAPRNKSFIPSQSATAPAAQPMAAQATLRQGGSGPLFGSPLDTRF
TFDTFVEGSSNRVALAAAKTIAEAGAGAVRFNPLFIHAGVGLGKTHLLQAIANAAIDSPR
NPRVVYLTAEYFMWRFATAIRDNDALTLKDTLRNIDLLVIDDMQFLQGKMIQHEFCHLLN
MLLDSAKQVVVAADRAPWELESLDPRVRSRLQGGMAIEIEGPDYDMRYEMLNRRMGSARQ
DDPSFEISDEILTHVAKSVTASGRELEGAFNQLMFRRSFEPNLSVDRVDELLSHLVGSGE
AKRVRIEDIQRIVARHYNVSRQELVSNRRTRVIVKPRQIAMYLAKMLTPRSFPEIGRRFG
GRDHTTVLHAVRKIEDLISGDTKLGHEVELLKRLINENNA