Protein Info for Atu0319 in Agrobacterium fabrum C58

Annotation: ubiquinone biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 504 to 521 (18 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 7 to 444 (438 residues), 579.3 bits, see alignment E=2.1e-178 PF03109: ABC1" amino acids 95 to 342 (248 residues), 239.6 bits, see alignment E=2.8e-75 PF01163: RIO1" amino acids 209 to 310 (102 residues), 23.5 bits, see alignment E=3.9e-09

Best Hits

Swiss-Prot: 40% identical to UBIB_MARHV: Probable protein kinase UbiB (ubiB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 100% identity to atu:Atu0319)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKE1 at UniProt or InterPro

Protein Sequence (524 amino acids)

>Atu0319 ubiquinone biosynthesis protein (Agrobacterium fabrum C58)
MSTLGAYFRLARVGWVLVREGVVLALPSDDLPAPAQLLKAALKPFARSKAKRAQRSDRLA
VAVERLGPSYVKMGQFLATRPDVVGADFADDLASLQDRMAFFPAAAAKANIEGSLGRSIS
ELYREFGDPIAAASIAQVHPAMVDTPKGPRKVAVKVIRPGVRQRFQNDLEAMYLIADLQQ
RFVRSARRLRPVEVTRTLEQTTKIEMDLRLEAAALSELAENTRQDPGFRVPEVDWERTGR
DVVTMEWIDGVKMSDIEGLKAAGHDLNKLADTLIQSFLRHTLRDGFFHADMHPGNLFVDA
KGEIVAVDMGIAGRLGKKERRFLAEILYGFITRDYMRVAEVHFEAGYVPGHHDKASFAQA
IRAIGEPIHGQPAETISMGKLLTLLFEVTELFDMETRPELVMLQKTMVVVEGVSRMLNPR
FNMWKAADPVVGGWIRDNLGPKRIATDLKDGVKAALKLAEAVPEIAAKTEKLHSELMYMS
ENGLRFDAQTAEAIGKAEARHTKWGRIALWVIALTLLYIAIRIS