Protein Info for Atu0313 in Agrobacterium fabrum C58

Annotation: RhtB family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 99.8 bits, see alignment E=7.2e-33

Best Hits

KEGG orthology group: None (inferred from 98% identity to agr:AGROH133_03463)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1Q0 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Atu0313 RhtB family transporter (Agrobacterium fabrum C58)
MTLTTLLAYATALFIAAAIPGPGMTAIVARALGSGFRETFFMGLGLVLGDMIYLTGVILG
LAFVAQTFQEAFMVLKFAGAAYLLYIAWKLWTAGLLPQDLKARKSTSIPMSFLSGLLITL
GNPKTMLFYVALVPTLIDIRMIGPSEYATLLALTFVVLMAVLLPYILLAAKARNLLKRPS
ALTILNRTAAGILAGTATMIAIRST