Protein Info for Atu0301 in Agrobacterium fabrum C58

Annotation: DNA polymerase III, beta chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00663: DNA polymerase III, beta subunit" amino acids 1 to 371 (371 residues), 302.1 bits, see alignment E=2.6e-94 PF00712: DNA_pol3_beta" amino acids 1 to 120 (120 residues), 109.1 bits, see alignment E=2.4e-35 PF02767: DNA_pol3_beta_2" amino acids 131 to 249 (119 residues), 110.4 bits, see alignment E=9.4e-36 PF02768: DNA_pol3_beta_3" amino acids 252 to 371 (120 residues), 112.3 bits, see alignment E=2e-36

Best Hits

Swiss-Prot: 54% identical to DPO3B_CAUVC: Beta sliding clamp (dnaN) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 100% identity to atu:Atu0301)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D1R0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Atu0301 DNA polymerase III, beta chain (Agrobacterium fabrum C58)
MRITLERSNLLKSLNHVHRVVERRNTIPILSNVLLRASGANLDMKATDLDLEITEATPAM
VEQAGATTVPAHLLYEIVRKLPDGSEVLLATNPDGSSMTVASGRSKFSLQCLPEADFPDL
TAGTFSHTFKLKAADLKMLIDRTQFAISTEETRYYLNGIFFHTIESNGELKLRAVATDGH
RLARADVDAPSGSEGMPGIIIPRKTVGELQKLMDNPELEVTVEVSDAKIRLAIGSVVLTS
KLIDGTFPDYQRVIPTGNDKEMRVDCQTFARAVDRVSTISSERGRAVKLALTDGQLTLTV
NNPDSGSATEEVAVGYDNDSMEIGFNAKYLLDITSQLSGEDAIFLLADAGSPTLVRDTAG
DDALYVLMPMRV