Protein Info for Atu0298 in Agrobacterium fabrum C58

Annotation: orotidine 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF00215: OMPdecase" amino acids 6 to 222 (217 residues), 213.1 bits, see alignment E=2.4e-67 TIGR01740: orotidine 5'-phosphate decarboxylase" amino acids 7 to 222 (216 residues), 209.4 bits, see alignment E=2.7e-66

Best Hits

Swiss-Prot: 100% identical to PYRF_AGRFC: Orotidine 5'-phosphate decarboxylase (pyrF) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to atu:Atu0298)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P58638 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Atu0298 orotidine 5 (Agrobacterium fabrum C58)
MTAREKLIVGLDVPTVQQAEDIVSKIGDEVLFYKIGYQLVFAGGLEFARDLVQSGKKVFL
DMKLLDIDNTVASGVENIARMGMSMLTLHAYPKAMRAAVKAAEGSGLCLLGVTVLTSMDD
SDLVEAGYASDARSLVLRRAEQAREAGMGGIVCSAEESTAVREILGPDLAVVTPGIRPAG
ADLGDQKRVMTPYDAIKAGSSHLVVARPIVRAEDPKAAARAILDDMLRASFPANQ