Protein Info for Atu0269 in Agrobacterium fabrum C58

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 PF13742: tRNA_anti_2" amino acids 16 to 109 (94 residues), 102.2 bits, see alignment E=2.3e-33 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 17 to 358 (342 residues), 393.4 bits, see alignment E=6.3e-122 PF01336: tRNA_anti-codon" amino acids 36 to 111 (76 residues), 48.2 bits, see alignment E=1.3e-16 PF02601: Exonuc_VII_L" amino acids 133 to 406 (274 residues), 297.5 bits, see alignment E=2.1e-92 amino acids 369 to 497 (129 residues), 58 bits, see alignment E=1.7e-19

Best Hits

Swiss-Prot: 100% identical to EX7L_AGRFC: Exodeoxyribonuclease 7 large subunit (xseA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to atu:Atu0269)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UIM4 at UniProt or InterPro

Protein Sequence (532 amino acids)

>Atu0269 exodeoxyribonuclease VII large subunit (Agrobacterium fabrum C58)
MSDIFSHTALSNLAEFSVSELSGSIKRTVETAFEQVRVRGEISGYRGPHSSGHAYFSLKD
DRARIDAVIWKGTFSRLKFRPEEGMEVIATGKITTFPGSSKYQIVIESLEPAGAGALMAL
LEDRRRRLAAEGLFDSARKRPLPFMPRVIGVVTSPTGAVIRDILHRISDRFPVHVVVWPV
KVQGEGSGEEVANAIRGFNALKPGGDIARPDVLIVARGGGSLEDLWSFNDEIVVRAAAES
EIPLISAVGHETDTTLIDYAADVRAPTPTGAAEMAVPVRAELEAQLSGLAARLSGSVSRQ
MDNRRQGVRALVRALPSLDQLLALPRRRFDEAASGLGRGLELTTLNKRRAFERSASGLRP
ETLLNGLKHHRQRITERMHRAETLVERRLLQGKGRVDSFDSALRSLPARLLGQLERQKER
VVTAARRADTAVLHRMAQNRSGLAAHDRILQSLSYKNVLNRGYAVIRDEENRPLTRAAAI
ASGAAVSMEFADGRVSAITTGEGTPAPETAAAPKKKPAKPASSDPGNQGNLF