Protein Info for Atu0190 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein (peptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 PF00005: ABC_tran" amino acids 30 to 189 (160 residues), 107.8 bits, see alignment E=2.2e-34 amino acids 307 to 458 (152 residues), 104.8 bits, see alignment E=1.8e-33 PF08352: oligo_HPY" amino acids 240 to 272 (33 residues), 21.1 bits, see alignment (E = 1e-07) amino acids 509 to 540 (32 residues), 19.5 bits, see alignment (E = 3.1e-07)

Best Hits

KEGG orthology group: K13896, microcin C transport system ATP-binding protein (inferred from 100% identity to atu:Atu0190)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKL2 at UniProt or InterPro

Protein Sequence (546 amino acids)

>Atu0190 ABC transporter, nucleotide binding/ATPase protein (peptide) (Agrobacterium fabrum C58)
MKETNTQPLLSVRDLSVAFHQGGATSVAVDHVSFDLMPGEVVALVGESGSGKSVTANSIL
KLLPYPAASHPSGKILFDGKDMLTLPERALRAVRGNDITMIFQEPMTSLNPLHTIERQIG
EILELHQAITGAEARQRTLELLLQVGIREPEKRLKAYPHELSGGQRQRVMIAMALANRPK
LLIADEPTTALDVTVQAQILELLGDLKTQHGMSMLFITHDLGIVRKFADRVCVMTKGKIV
ETGTVEQVFTDPQHAYTRHLLAAEPKGEPPHSDASKPVVMQGDDIKVWFPIKAGLMRRVI
DHVKAVDGIDITLRAGQTVGVVGESGSGKTTLGLALSRLIASKGRISFIGQSIDSYSYEM
MKPLRNRLQVVFQDPYGSLSPRMSVGEIIAEGLKVHERSLSADERDTRVATALEEVGLDP
ATRWRYPHEFSGGQRQRIAIARAMVLKPRFVMLDEPTSALDMSVQAQVVDLLRDLQAKHE
LAYLFISHDLRVVKALANDLIVMRHGKVVESGPAAEIFANPQQDYTKALLAAAFNIEAVE
TKAVSQ