Protein Info for Atu0189 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (peptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 183 to 207 (25 residues), see Phobius details amino acids 227 to 260 (34 residues), see Phobius details amino acids 296 to 322 (27 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details PF12911: OppC_N" amino acids 25 to 61 (37 residues), 24.1 bits, see alignment 2.7e-09 PF00528: BPD_transp_1" amino acids 197 to 378 (182 residues), 111.5 bits, see alignment E=4.1e-36

Best Hits

KEGG orthology group: K13895, microcin C transport system permease protein (inferred from 100% identity to atu:Atu0189)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D203 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Atu0189 ABC transporter, membrane spanning protein (peptide) (Agrobacterium fabrum C58)
MSLAQPAGTETLVKPKRPWFSPTTKRRWQNFKANRRGYWSFWLFLILFFLSLIAEFIAND
KPILASYKGEILVPVMVDYPEEKFGGFLAQTDYKSSFIQDEINANGWMIWPPIRYSYQTV
NSNIPHSAPTAPFWLMDEKERCSAYPQGNADPGCTLGNLNWLGTDNQARDVTARMIYGFR
ISVLFGLTLTIASALVGVTAGAIQGYFGGWTDLLLQRFIEIWSSMPVLYILLIIAAILPP
GFFVLLGIMLLFSWVGFVGIVRAEFLRARNFEYVRAARALGVGNWTIMFRHLLPNAMVAT
LTFLPFILSGSITTLTSLDFLGFGMPPGSPSLGEMIAQGKNNLQAPWLGLTAFFTMSIML
SLLIFVGEAVRDAFDPRKTFR