Protein Info for Atu0186 in Agrobacterium fabrum C58

Annotation: penicillin-insensitive murein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF03411: Peptidase_M74" amino acids 54 to 296 (243 residues), 328.7 bits, see alignment E=1.2e-102

Best Hits

KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 100% identity to atu:Atu0186)

Predicted SEED Role

"Murein endopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKL5 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Atu0186 penicillin-insensitive murein endopeptidase (Agrobacterium fabrum C58)
MTAGSPRVLKAALLAMSVVSALQLQIETASAEDRPAKEVFGHMALPSAAASQPIGSYAKG
CQSGAIAMPTDGPGWQAMRLSRNRRWGQPQLISFLERFSQDAQKIGWPGLLLGDISQPRG
GPMLTGHASHQIGLDVDVWWRPMPSPRLTVEQRETVPFISMLDKSKFLTVDDRKWSPLNA
RLVMMAASYPQVERVFVNPAIKQKLCQTWTGDRTFMGKIRPIYGHDEHFHIRLECPPGAP
NCKPQAEVGKGDGCDKSLAWWFTKEPWAPPKKDPNAKPVKPRQVMVSDLPAACAAVAAAP
SANPEGIAAQAYSSSPAQAVRQQNVEQVIQNAPAIQPPSDIPLPTQRPTLN