Protein Info for Atu0179 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05861: PhnI
  • amino acids 1 to 352 (352 residues), 549.9 bits, E=1e-169

Best Hits

Swiss-Prot: 81% identical to PHNI_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (phnI) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06164, PhnI protein (inferred from 100% identity to atu:Atu0179)

MetaCyc: 81% identical to alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (Sinorhizobium meliloti 1021)
RXN-17957 [EC: 2.7.8.37]

Predicted SEED Role

"PhnI protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• glyphosate degradation III (7/7 steps found)
• methylphosphonate degradation I (2/5 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.37

Sequence Analysis Tools

See A9CKL9 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Atu0179 hypothetical protein (Agrobacterium fabrum C58)
MYVAVKGGETAIANAHRLLADQRRGDRDLPAMTVAQIVSQLSLAVDRVMAEASLYDQSLA
ALAVKQARGDMIEAIFLLRAYRTTLPRFGYSVPVDTADMVVQRRVSATYKDLPGGQLLGP
TFDYTHRLLDPSLLEDEGVETATQREGEPEYVVRVSDILAQEGLIESDGDMPDDHIAGDL
TREPMEFPMPRDLRLQSLARGDEGFLLALAYSTQRGYGRTHPFVGEIRIGEVEVELDVPE
LGFSVSLGDIKVTECQMVNQFKGSAKAPPQFTRGYGLVFGQSERKAMAMSLVDRALRAGE
FGEDVVAPAQDEEFVISHADNVQATGFVEHLKLPHYVDFQAELGLVRKMRADFEAINANG
AEWMSDAAE