Protein Info for Atu0175 in Agrobacterium fabrum C58

Annotation: acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 TIGR03308: phosphonate metabolim protein, transferase hexapeptide repeat family" amino acids 2 to 203 (202 residues), 357 bits, see alignment E=1.6e-111 PF14602: Hexapep_2" amino acids 109 to 142 (34 residues), 30.8 bits, see alignment 1.9e-11 PF00132: Hexapep" amino acids 109 to 142 (34 residues), 38.9 bits, see alignment 4.7e-14

Best Hits

KEGG orthology group: K00680, [EC: 2.3.1.-] (inferred from 100% identity to atu:Atu0175)

Predicted SEED Role

"Chloramphenicol acetyltransferase (EC 2.3.1.28)" (EC 2.3.1.28)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.28

Use Curated BLAST to search for 2.3.1.- or 2.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKM1 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Atu0175 acetyltransferase (Agrobacterium fabrum C58)
MSVKVGLEPVIHESARVTNSSIGRYTEISERCRLEEVEMGDYSYVMQDGAIWCATIGKFV
NIAASVRINATNHPMQRATLHHFTYRARSYWDDAEDETDFFAARRAKRVVIGHDVWIGHG
ATILPGITVGNGAVIGAGAVVSKDVAPYTIVGGVPARLIRERFPAELGKRMDDLNWWDWD
HARLRSALEDFRALDAEDFVAKYGG