Protein Info for Atu0174 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein (phosphonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR02315: phosphonate ABC transporter, ATP-binding protein" amino acids 4 to 243 (240 residues), 318.4 bits, see alignment E=1.5e-99 PF00005: ABC_tran" amino acids 19 to 174 (156 residues), 126.1 bits, see alignment E=7.8e-41

Best Hits

Swiss-Prot: 100% identical to PHNC_AGRFC: Phosphonates import ATP-binding protein PhnC (phnC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 100% identity to atu:Atu0174)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UIW7 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Atu0174 ABC transporter, nucleotide binding/ATPase protein (phosphonate) (Agrobacterium fabrum C58)
MSFHLKQVTRRFGKHTAVDSVDVEIPQGQMVGVIGRSGAGKSTLLRMINRLVDPSSGSIH
FNDTEVSSLKGAALRAWQRDCAMIFQQFNLVPRLDVLTNVMLGRLNHRSTALSLFNIFSH
EERLMAIAALERLGIEHVAMQAAGTLSGGQQQRVAIARALMQSPKMVLADEPIASLDPLN
AKIVMDALRDINEREGITVITNLHTLDTARNYCERIIGMSQGRVVFDGTPAELTAAAVTE
IYGTDSQGSGIDETMTSTSINIPGAQLAARPVQQSAGPEPLALAGL