Protein Info for Atu0171 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (phosphonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 297 to 327 (31 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details amino acids 389 to 406 (18 residues), see Phobius details amino acids 418 to 436 (19 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 226 to 443 (218 residues), 254.7 bits, see alignment E=4.8e-80 PF00528: BPD_transp_1" amino acids 271 to 436 (166 residues), 52.2 bits, see alignment E=3.3e-18

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to atu:Atu0171)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKM3 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Atu0171 ABC transporter, membrane spanning protein (phosphonate) (Agrobacterium fabrum C58)
MSSSFILNTAERERLTAAHRHVFNRSFMQRYGLLVGLLVATAYLIGCFFFFNVGPAFMQG
RWDRASSYIQDWYSWRAQPRLRFEDGKVAPQWSSRGQYPADAKIDWLQPLPDGGYSVVYA
GTQNRLDITPTRVDVYVDGKNYPVIINDDAVVAPQGLPDEIQQDGKKVLVHYGFAGQAEI
RTSQVYVQRRFLGWANFLFDTKSEFWGKGYGELAALALWGERLDPARSNIGHMVDDFLDN
SVWQHADILSKLMQTLVMAFVGTLFGTLVALPLAFIAARNITANRAANWGMKRLFDFLRS
IDMLIWALFFTRSFGPGPIPGIAAIFFTDTGALGKVYAEALENVDDKQREGVKSVGASPI
AVNRFGVLPQVLPVFISQSLYFWESNTRSATIIGAVGAGGIGLKLLEAMGTNADWDKVAY
MVLLILFVVFLFDHISNSLRSRLIGKTQH