Protein Info for Atu0163 in Agrobacterium fabrum C58

Annotation: tonB protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details PF13103: TonB_2" amino acids 225 to 298 (74 residues), 42.7 bits, see alignment E=5.1e-15 TIGR01352: TonB family C-terminal domain" amino acids 239 to 307 (69 residues), 62.8 bits, see alignment E=1.4e-21 PF03544: TonB_C" amino acids 239 to 306 (68 residues), 28.9 bits, see alignment E=1.3e-10

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 100% identity to atu:Atu0163)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKM8 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Atu0163 tonB protein (Agrobacterium fabrum C58)
MTENGFPQARHSRLGEVTLWSAAALLMLSVHAGFAYYLMQEPEEQDAGGQPPAAIMIEMA
AIPEAVKTEETTQAQDVEDTREVKSESSEPVEEAAPEEPPPPEPVAETPPPEPVQPPEPP
VEEIVEPQEIPEPVEPIDPVQEQMMAELENVEVPLPVMRPPPPRVEKKVEKKEPEEKKKV
ERQRPKPQQASEFRETAKAEAQQSNRTAASRSNAGFFSSSSVSKADWDAKVRSAIKRRLA
RAAGKSGMAITVSFKIDSGGSVGGVSILSSTGNSAMDQKLLAVIQKTSVSPPPPGVNPSF
TLPVLFE