Protein Info for Atu0162 in Agrobacterium fabrum C58

Annotation: biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details PF02472: ExbD" amino acids 15 to 134 (120 residues), 93.8 bits, see alignment E=4.5e-31 TIGR02803: TonB system transport protein ExbD" amino acids 16 to 137 (122 residues), 212.5 bits, see alignment E=7.4e-68

Best Hits

Swiss-Prot: 63% identical to EXBD_ECO57: Biopolymer transport protein ExbD (exbD) from Escherichia coli O157:H7

KEGG orthology group: K03559, biopolymer transport protein ExbD (inferred from 100% identity to atu:Atu0162)

MetaCyc: 63% identical to Ton complex subunit ExbD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biopolymer transport protein ExbD/TolR" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKM9 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Atu0162 biopolymer transport protein (Agrobacterium fabrum C58)
MAGGIRENSGDDLSENHEINVTPFIDVMLVLLIIFMVAAPLATVDVNVDLPASTAKPAER
PEEPLYLTVKDDLSLNLGNDAVAREALAAAIDRQTGGKKDTRIFLRADKAVDYGHFMEIM
NLLRDAGYLKIALVGLENAAAVSQPAGSTTAQPSGQPAAPAGQGTAP