Protein Info for Atu0161 in Agrobacterium fabrum C58

Annotation: biopolymer transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 116 to 138 (23 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 106 to 318 (213 residues), 356.6 bits, see alignment E=2.5e-111 PF01618: MotA_ExbB" amino acids 196 to 299 (104 residues), 111.3 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to atu:Atu0161)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D226 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Atu0161 biopolymer transport protein (Agrobacterium fabrum C58)
MAVTLLTGLSAGAVFAQQAPETQIQSAPPTETVQPSQAPVAPATPSAPTAEPSPTAQPSS
PQPAQFEQPAQTNQTPAPSETSTPVETVNAEPASAERRTDIPHNLSPWGMFMAADWVVKG
VMIGLAFASLVTWTVWVAKSIELAGARVRAGSTLKVIRRAKTLAEATDAVENKGGPAALM
LRMATHEMQLSDAVVEHTDGGGIKERVSSALSRIETHAGRRMSRGTGALATIGSTAPFVG
LFGTVWGIMNSFISISESQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSITG
YRHLLADAAAGVERLVSRDLDFRRIPPGSTSKPAVSLVGR