Protein Info for Atu0156 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 signal peptide" amino acids 12 to 20 (9 residues), see Phobius details transmembrane" amino acids 21 to 37 (17 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details PF06912: DUF1275" amino acids 22 to 212 (191 residues), 112.6 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0156)

Predicted SEED Role

"FIG00983844: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D231 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Atu0156 hypothetical protein (Agrobacterium fabrum C58)
MTRQRRRNIIRARRTGTGIALVAAISFIAGMTDAVGLHLSGDFVSFMTGNTTRAAISLEA
GVYSHAAKLLFAIVAFVAGNAGGIVVAHKFDRSILAVLVGVGLLVAIAALLRGDAFALTQ
FYLVVFAMGMVNAAVEHIEGLPIGLTYVTGALSRFGRGIGRFLLGERSLDWGIQIVPWLG
MISGAICGAVLGVTLQSGALWVVAATVFAVAVATLVIPRSLRHRYNQRVRIRRIAP