Protein Info for Atu0125 in Agrobacterium fabrum C58

Annotation: peptide methionine sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 49 to 204 (156 residues), 209 bits, see alignment E=2.3e-66 PF01625: PMSR" amino acids 50 to 206 (157 residues), 192.8 bits, see alignment E=2.5e-61

Best Hits

Swiss-Prot: 100% identical to MSRA_AGRFC: Peptide methionine sulfoxide reductase MsrA (msrA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 100% identity to atu:Atu0125)

MetaCyc: 56% identical to methionine sulfoxide reductase A (Escherichia coli K-12 substr. MG1655)
L-methionine (S)-S-oxide reductase. [EC: 1.8.4.13]; Peptide-methionine (S)-S-oxide reductase. [EC: 1.8.4.13, 1.8.4.11]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D255 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Atu0125 peptide methionine sulfoxide reductase (Agrobacterium fabrum C58)
MFLFDTLSKKTTMPTEETALPGREEALAVPETHFVNGRPLKGPYPDGLEIIYLGMGCFWG
AERLFWKTPGVWVTAVGYAGGFTRNPTYHETTTGQTGHAEVVKVVYDPAVISLSGLLKIF
FEEHDPTQGMRQGNDVGTTYRSAIYATTEGQLQQAQKARDAFQQALDEAGHGHAITTEIG
PLETFYYAEDYHQQYLAKNPGGYCGLRGTGVSCNIG