Protein Info for Atu0089 in Agrobacterium fabrum C58

Annotation: N-utilization substance protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 TIGR01953: transcription termination factor NusA" amino acids 9 to 346 (338 residues), 467.6 bits, see alignment E=2.1e-144 PF08529: NusA_N" amino acids 9 to 129 (121 residues), 131.4 bits, see alignment E=6e-42 PF00575: S1" amino acids 136 to 198 (63 residues), 32.7 bits, see alignment E=2.3e-11 PF13184: KH_NusA_1st" amino acids 203 to 280 (78 residues), 116.9 bits, see alignment E=1.1e-37 PF26594: KH_NusA_2nd" amino acids 284 to 349 (66 residues), 93.2 bits, see alignment E=2.1e-30 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 369 to 418 (50 residues), 67.7 bits, see alignment 7.4e-23 PF14520: HHH_5" amino acids 377 to 415 (39 residues), 21.1 bits, see alignment 1.1e-07

Best Hits

Swiss-Prot: 56% identical to NUSA_RICCN: Transcription termination/antitermination protein NusA (nusA) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to atu:Atu0089)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKQ5 at UniProt or InterPro

Protein Sequence (538 amino acids)

>Atu0089 N-utilization substance protein A (Agrobacterium fabrum C58)
MAVSANRLELLQIADAVAREKVIDREIVLAAMADAIQKAARSRYGSETNIRADINSKTGE
IRLQRLLEVVEAAEDYSTQIPLELARDRNPDAKLGDFIADPLPPMDFGRIAAQSAKQVIV
QKVREAERDRQYDEFKDRIGEIVNGTVKRVEYGNVIVDLGRGEGIIRRDEMIPRENMRYG
DRVRAYVYDVRREQRGPQIFLSRTHPQFMVKLFTMEVPEIYDGIIQIKSVARDPGSRAKI
AVISNDSSIDPVGACVGMRGSRVQAVVGELQGEKIDIIPWSQEPASFIVNALQPAEVAKV
VLDEESERIEVVVPDEQLSLAIGRRGQNVRLASQLTGWDIDIMTEQEESERRQKEFNERT
ALFMEALDVDEMVGQVLASEGFAQVEELAYVDLDEITSIDGFDEDTADEIQTRAREYLER
LEAEMDAKRKELGVTDELRQIDGLTSQMMVALGEDGIKTIEDFAGCAADDLVGWSERKDG
ETKKFEGIFSKLDVSRVEAENMVVQARLLAGWITAEELASEQEVEAEAAEEADTAEQE