Protein Info for Atu0085 in Agrobacterium fabrum C58

Annotation: tRNA pseudouridine 55 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 18 to 226 (209 residues), 218.5 bits, see alignment E=4.2e-69 PF01509: TruB_N" amino acids 39 to 187 (149 residues), 176.1 bits, see alignment E=5.9e-56 PF16198: TruB_C_2" amino acids 188 to 253 (66 residues), 54 bits, see alignment E=1.5e-18

Best Hits

Swiss-Prot: 100% identical to TRUB_AGRFC: tRNA pseudouridine synthase B (truB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to atu:Atu0085)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UJ53 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Atu0085 tRNA pseudouridine 55 synthase (Agrobacterium fabrum C58)
MSKPRKQQHRKPKGRPISGWLILDKPLDFGSTEAVSKIKWLFNAQKAGHAGTLDPLASGM
LPIALGDATKTVPYVMDGRKIYEFTVTWGEQRATDDLEGEVVESSDQRPEEQAIRDILPN
YTGVIMQTPPQFSAIKIAGERAYDLARDGETVEIPAREVEIHRLTLLACPDADTAHFEVE
CGKGTYVRALARDMGRDLGCFGHISELRRTMVAPFGEDMMVPLETLTALEAIEDRDERLE
ALDAFLIDTAEALSSLPRLIINDDQAHRLKMGNPILLRGRDAPANHPEAYATAQGKLVAI
GEIGEGEFRPKRVFG