Protein Info for Atu0084 in Agrobacterium fabrum C58

Annotation: 30S ribosomal protein S15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 TIGR00952: ribosomal protein uS15" amino acids 5 to 89 (85 residues), 125.1 bits, see alignment E=5.4e-41 PF00312: Ribosomal_S15" amino acids 8 to 88 (81 residues), 122.9 bits, see alignment E=2.5e-40

Best Hits

Swiss-Prot: 100% identical to RS15_AGRFC: 30S ribosomal protein S15 (rpsO) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02956, small subunit ribosomal protein S15 (inferred from 100% identity to atu:Atu0084)

MetaCyc: 63% identical to 30S ribosomal subunit protein S15 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S15p (S13e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UJ54 at UniProt or InterPro

Protein Sequence (89 amino acids)

>Atu0084 30S ribosomal protein S15 (Agrobacterium fabrum C58)
MSITAERKAALITEYATKAGDTGSPEVQVAILTERINNLTGHFKDHKKDNHSRRGLLTLV
SSRRSLLDYLKKKDEARYTKLIGALGIRR