Protein Info for Atu0074 in Agrobacterium fabrum C58

Annotation: molybdopterin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 36 to 50 (15 residues), see Phobius details PF00899: ThiF" amino acids 12 to 249 (238 residues), 229.5 bits, see alignment E=1.7e-72

Best Hits

Swiss-Prot: 50% identical to TTUC_THET2: Sulfur carrier protein adenylyltransferase (ttuC) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0074)

MetaCyc: 50% identical to [sulfur carrier protein TtuB] adenylyltransferase (Thermus thermophilus)
2.7.7.M15 [EC: 2.7.7.M15]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeB" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.M15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D290 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Atu0074 molybdopterin biosynthesis protein (Agrobacterium fabrum C58)
MDPLSPEEIERYKRHILLPEIGGAGQQRLKAARVLVIGAGGLGAPVLHYLAAAGVGTLGM
IDDDVVSLSNLQRQVIHDTGTIGELKTESARKTIARLNPHVRTLMYEERFSQVWAHDHLP
SFDLLIDGSDNFDTRYAAADAAEAAKRPLVTGAVGRFDGSVTVLKPYETNAEGSLLPGYR
DLFPAPPPQGLIPNCAETGIVGALTGVIGTLMAMEAIKVITGAGEPLIGRLLLYDALSAR
FETVKYKRRAREK