Protein Info for Atu0064 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 42 to 65 (24 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 78 to 349 (272 residues), 156.6 bits, see alignment E=3.5e-50

Best Hits

Swiss-Prot: 84% identical to FRCC_RHIML: Fructose import permease protein FrcC (frcC) from Rhizobium meliloti

KEGG orthology group: K10553, fructose transport system permease protein (inferred from 100% identity to atu:Atu0064)

Predicted SEED Role

"Fructose ABC transporter, permease component FrcC" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKR6 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Atu0064 ABC transporter, membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MSDQPVRAQPHNEFEKVLSGSSTQVAAFDTHNKSLLEKFQHFLHSSPAAVPLIVLVLSLA
IFGMTLGGKFFSAFSLTLILQQVAIVGIVGAAQSLVILTAGIDLSVGAIMVLSSVVMGQF
TFRYGLPAELSIICGLAVGAFCGFINGVLVSRMRLPPFIVTLGMWQIVLATNFLYSANET
IRAQDIVQQAPILQFFGNNIRIGNAVFTYGVLAMVLLVALLWYVLNRTAWGRHLYAVGDD
PDAAELAGVNVKRMLTTVYTLSGLICAFAGWALIGRIGSVSPTAGQFANIESITAVVIGG
ISLFGGRGSIMGMIFGALIVGVFSLGLRLIGTDPQWTYLLIGVLIILAVAIDQWIRKVAG